PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10020723m
Common NameCARUB_v10020723mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 298aa    MW: 33284.2 Da    PI: 7.2781
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10020723mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd++l+  v+++G g W+t + + g++R++k+c++rw +yl
  Carubv10020723m 14 KGVWTQEEDQKLIAHVQRHGEGGWRTLPDKAGLKRCGKSCRLRWANYL 61
                     799*******************************************97 PP

2Myb_DNA-binding54.72.3e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +++eE++  +++++ +G++ W++Iar+++ gRt++++k++w+++
  Carubv10020723m  67 RGDFSQEEEDSMINLHAVHGNK-WSAIARRLP-GRTDNEIKNHWNTH 111
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.212961IPR017930Myb domain
SuperFamilySSF466891.2E-2911108IPR009057Homeodomain-like
SMARTSM007177.0E-131363IPR001005SANT/Myb domain
PfamPF002494.8E-151461IPR001005SANT/Myb domain
CDDcd001671.70E-91761No hitNo description
PROSITE profilePS5129425.51962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-2665117IPR009057Homeodomain-like
SMARTSM007177.1E-1566114IPR001005SANT/Myb domain
PfamPF002493.6E-1567111IPR001005SANT/Myb domain
CDDcd001677.74E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009625Biological Processresponse to insect
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MVRTPCCRAE GLKKGVWTQE EDQKLIAHVQ RHGEGGWRTL PDKAGLKRCG KSCRLRWANY  60
LRPDIKRGDF SQEEEDSMIN LHAVHGNKWS AIARRLPGRT DNEIKNHWNT HIKKRLIKKG  120
IDPVTHKSLL DNLEEKSTVH QEKDDQKSKD NKSSRSSARF LNKVANRFGQ RVSQSVLSDI  180
IGSGGSLTSH ATPIISSSEC ERSTSSSSTP TSSDLLTNQS INVDATTPLS SSTCSDSSDL  240
FLYDDIFGDI EDTTRLISSR FLSNVVSHDG EEFLMLDGSC LENTSFMREL TMILQED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935331e-143AB493533.1 Arabidopsis thaliana At1g74080 mRNA for hypothetical protein, partial cds, clone: RAAt1g74080.
GenBankAF3719831e-143AF371983.2 Arabidopsis thaliana putative transcription factor MYB122 (MYB122) mRNA, complete cds.
GenBankBT0289311e-143BT028931.1 Arabidopsis thaliana At1g74080 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302618.10.0hypothetical protein CARUB_v10020723mg
SwissprotQ9C9C81e-145MY122_ARATH; Transcription factor MYB122
TrEMBLR0GII90.0R0GII9_9BRAS; Uncharacterized protein
STRINGBra015939.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74080.11e-132myb domain protein 122